PE Rabbit anti-Human CD270/HVEM monoclonal antibody

Size

POA

SKU:: A25414
Additional Names:: ATAR|CD270|HVEA|HVEM|LIGHTR|TNF receptor superfamily member 14|TNFRSF14|TR2
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC
Uniprot:: Q92956
Synonyms:: ATAR;CD270;CD40-like protein;herpes virus entry mediator A;HVEA;HVEM;LIGHTR;TR2;tumor necrosis factor receptor superfamily member 14;tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator);Tumor necrosis factor receptor-like 2;tumor necrosis factor receptor-like gene2
Extra Details:: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.