A2541
IL8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2541
- Additional Names:
- GCP-1|GCP1|IL8|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1|SCYB8
- Application:
- ELISA, WB
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
- Uniprot:
- P10145
- Synonyms:
- alveolar macrophage chemotactic factor I;beta endothelial cell-derived neutrophil activating peptide;beta-thromboglobulin-like protein;C-X-C motif chemokine 8;chemokine (C-X-C motif) ligand 8;emoctakin;GCP-1;GCP1;granulocyte chemotactic protein 1;IL8;interleukin 8;interleukin-8;LECT;LUCT;lung giant cell carcinoma-derived chemotactic protein;lymphocyte derived neutrophil activating peptide;LYNAP;MDNCF;MONAP;monocyte-derived neutrophil chemotactic factor;monocyte-derived neutrophil-activating peptide;NAF;NAP-1;NAP1;neutrophil-activating peptide 1;Neutrophil-activating protein 1;Protein 3-10C;SCYB8;small inducible cytokine subfamily B, member 8;T-cell chemotactic factor;tumor necrosis factor-induced gene 1
- Extra Details:
- The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.
- Shipping Conditions:
- Blue Ice



