CD79b Rabbit monoclonal antibody

Size

POA

SKU:: A25358
Additional Names:: B29|Ig-beta|Igb|Igbeta
Application:: ELISA, Flow Cytometry, WB, IF, ICC
Molecular Weight:: 30-50kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD
Uniprot:: P15530
Synonyms:: AGM6;B-cell antigen receptor complex-associated protein beta chain;B-cell-specific glycoprotein B29;B29;CD79b antigen (immunoglobulin-associated beta);CD79b molecule, immunoglobulin-associated beta;Ig;Ig-be;Ig-beta;IGB;Igbe;Igbeta;immunoglobulin-associated B29 protein;immunoglobulin-associated beta
Extra Details:: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.