[KD Validated] Cyclophilin F Rabbit monoclonal antibody

Size

POA

SKU:: A25355
Additional Names:: Cyp-D|CyP-M|CYP3|CypD
Application:: ELISA, WB, IHC-P
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Uniprot:: P30405
Synonyms:: cyclophilin 3;cyclophilin D;cyclophilin F;Cyp-D;CyP-M;CYP3;CypD;mitochondrial cyclophilin;peptidyl-prolyl cis-trans isomerase F, mitochondrial;peptidyl-prolyl cis-trans isomerase, mitochondrial;PPIase F;rotamase F
Extra Details:: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.