A25260
DSPP Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25260
- Additional Names:
- DFNA39|DGI1|DMP3|DPP|DSP|DSPP
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 97kDa,131kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVT
- Uniprot:
- Q9NZW4
- Synonyms:
- deafness, autosomal dominant 39;dentin phosphophoryn;dentin phosphoprotein;dentin phosphoryn;dentin sialophosphoprotein;dentin sialoprotein;DFNA39;DGI1;DMP3;DPP;DSP
- Extra Details:
- This gene encodes a member of the small integrin-binding ligand N-linked glycoprotein (SIBLING) family of proteins. The encoded preproprotein is secreted by odontoblasts and proteolytically processed to generate two principal proteins of the dentin extracellular matrix of the tooth, dentin sialoprotein and dentin phosphoprotein. These two protein products may play distinct but related roles in dentin mineralization. Mutations in this gene are associated with dentinogenesis imperfecta and dentin dysplasia. This gene is present in a gene cluster on chromosome 4. Allelic differences due to repeat polymorphisms have been found for this gene.
- Shipping Conditions:
- Blue Ice



