IL33 Rabbit polyclonal antibody

Size

£152.00

SKU:: A25253
Additional Names:: 9230117N10Rik|Il-33|Il1f11|NF-HEV
Application:: ELISA, WB
Molecular Weight:: 20kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Uniprot:: Q8BVZ5
Synonyms:: 9230117N10Rik;C9orf26;DVS27;DVS27-related protein;Il-;Il-33;Il1f;Il1f11;interleukin-1 family member 11;interleukin-33;NF-H;NF-HEV;NFEHEV;nuclear factor for high endothelial venules;nuclear factor from high endothelial venules
Extra Details:: Enables cytokine activity and interleukin-33 receptor binding activity. Involved in several processes, including interleukin-33-mediated signaling pathway; microglial cell activation involved in immune response; and regulation of gene expression. Acts upstream of or within several processes, including negative regulation of macrophage proliferation; positive regulation of cellular defense response; and positive regulation of macromolecule metabolic process. Located in nucleus. Is expressed in several structures, including adrenal gland; alimentary system; genitourinary system; nervous system; and sensory organ. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in candidiasis; inflammatory bowel disease; and peptic ulcer disease. Orthologous to human IL33 (interleukin 33).

Shipping Conditions:: Blue Ice