A25251
ID2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25251
- Additional Names:
- bHLHb26|GIG8|ID2|ID2A|ID2H
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR
- Uniprot:
- Q02363
- Synonyms:
- bHLHb26;cell growth-inhibiting gene 8;class B basic helix-loop-helix protein 26;DNA-binding protein inhibitor ID-2;DNA-binding protein inhibitor ID2;GIG8;helix-loop-helix protein ID2;ID2A;ID2H;inhibitor of differentiation 2;Inhibitor of DNA binding 2;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein;inhibitor of DNA binding 2, HLH protein
- Extra Details:
- The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3.
- Shipping Conditions:
- Blue Ice