A25234
ZNF10 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25234
- Additional Names:
- KOX1|ZNF10
- Application:
- ELISA, WB
- Molecular Weight:
- 66kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SALIVHQRIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
- Uniprot:
- P21506
- Synonyms:
- KOX1;zinc finger protein 10;zinc finger protein 10 (KOX 1);zinc finger protein KOX1
- Extra Details:
- The protein encoded by this gene contains a C2H2 zinc finger, and has been shown to function as a transcriptional repressor. The Kruppel-associated box (KRAB) domain of this protein is found to be responsible for its transcriptional repression activity. RING finger containing protein TIF1 was reported to interact with the KRAB domain, and may serve as a mediator for the repression activity of this protein.
- Shipping Conditions:
- Blue Ice

