A25233
Type S APL Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25233
- Additional Names:
- PML/RARA|Type L APL
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRK MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
- Uniprot:
- P10276, P29590
- Synonyms:
- E3 SUMO-protein ligase PML;MYL;NR1B1;nuclear receptor subfamily 1 group B member 1;nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form;PML-DDX5-RARA fusion;PML-DDX5-RARA fusion protein;PML/RARA fusion;PP8675;probable transcription factor PML;promyelocytic leukemia protein;promyelocytic leukemia, inducer of;protein PML;RAR;RAR-alpha;retinoic acid nuclear receptor alpha variant 1;retinoic acid nuclear receptor alpha variant 2;retinoic acid receptor alpha;retinoic acid receptor, alpha polypeptide;RING finger protein 71;RING-type E3 SUMO transferase PML;RNF71;TRIM19;tripartite motif protein TRIM19;tripartite motif-containing protein 19
- Extra Details:
- Promyelocytic leukemia/retinoic acid receptor alpha or PML-RARA refers to an abnormal fusion gene sequence. It is a specific rearrangement of genetic material from two separate chromosomes (chromosomal translocation) and is associated with a specific type of leukemia.Promyelocytic leukemia (PML) is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Retinoic acid receptor alpha(RARA), regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia.
- Shipping Conditions:
- Blue Ice