A25228
NOD2 Rabbit polyclonal antibody

Size
POA
- SKU:
- A25228
- Additional Names:
- ACUG|BLAU|BLAUS|CARD15|CD|CLR16.3|IBD1|NLRC2|NOD2|NOD2B|PSORAS1|YAOS
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQ
- Uniprot:
- Q9HC29
- Synonyms:
- ACUG;BLAU;BLAUS;CARD15;caspase recruitment domain family, member 15;caspase recruitment domain protein 15;caspase recruitment domain-containing protein 15;CD;CLR16.3;IBD1;inflammatory bowel disease protein 1;NLR family, CARD domain containing 2;NLRC2;NOD-like receptor C2;NOD2B;nucleotide-binding oligomerization domain 2;nucleotide-binding oligomerization domain-containing protein 2;nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 2;PSORAS1;YAOS
- Extra Details:
- This gene is a member of the Nod1/Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice







