ENPP2 Rabbit polyclonal antibody

Size

POA

SKU:: A2522
Additional Names:: ATX|ATX-X|AUTOTAXIN|ENPP2|LysoPLD|NPP2|PD-IALPHA|PDNP2
Application:: ELISA, WB
Molecular Weight:: 110-115kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLHTYESEI
Uniprot:: Q13822
Synonyms:: ATX;ATX-X;AUTOTAXIN;autotaxin-t;E-NPP 2;ectonucleotide pyrophosphatase/phosphodiesterase family member 2;extracellular lysophospholipase D;LysoPLD;NPP2;PD-IALPHA;PDNP2;phosphodiesterase I/nucleotide pyrophosphatase 2;plasma lysophospholipase D
Extra Details:: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

Shipping Conditions:: Blue Ice