A25216
CXCR3-B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25216
- Additional Names:
- CD182|CD183|CKR-L2|CMKAR3|CXCR3|GPR9|IP10-R|Mig-R|MigR
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
- Uniprot:
- P49682-2
- Synonyms:
- C-X-C chemokine receptor type 3;CD182;CD183;chemokine (C-X-C motif) receptor 3;chemokine receptor 3;CKR-L2;CMKAR3;G protein-coupled receptor 9;GPR9;interferon-inducible protein 10 receptor;IP-10 receptor;IP10-R;Mig receptor;Mig-R;MigR
- Extra Details:
- This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).
- Shipping Conditions:
- Blue Ice