ABflo[R] 488 Rabbit anti-Mouse CD321/JAM-1 monoclonal antibody

Size

POA

SKU:: A25209
Additional Names:: 9130004G24|ESTM33|JAM|JAM-1|JAM-A|JAM-A/CD321|Jcam|Jcam1|Ly106
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA
Uniprot:: O88792
Synonyms:: 9130004G24;AA638916;BV11 antigen;CD321;ESTM3;ESTM33;F11 receptor/F11R;JAM;JAM-;JAM-1;JAM-A;JAM1;JAMA;Jcam;Jcam1;junction cell adhesion molecule A;junction cell adhesion molecule1;junctional adhesion molecule 1;junctional adhesion molecule A;KAT;Ly10;Ly106;PAM-1;platelet adhesion molecule 1;platelet F11 receptor
Extra Details:: Predicted to enable PDZ domain binding activity; integrin binding activity; and protein homodimerization activity. Involved in intestinal absorption; regulation of cytokine production; and regulation of membrane permeability. Acts upstream of or within cell adhesion and epithelial cell differentiation. Located in bicellular tight junction. Is expressed in several structures, including 4-8 cell stage embryo; alimentary system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human F11R (F11 receptor).

Shipping Conditions:: Blue Ice