[KD Validated] SCD Rabbit polyclonal antibody

Size

POA

SKU:: A25168
Additional Names:: FADS5|hSCD1|MSTP008|SCD|SCD1|SCDOS
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
Uniprot:: O00767
Synonyms:: acyl-CoA desaturase;delta(9)-desaturase;FADS5;fatty acid desaturase;hSCD1;MSTP008;predicted protein of HQ0998;SCD1;SCDOS;stearoyl-CoA desaturase;stearoyl-CoA desaturase (delta-9-desaturase);stearoyl-CoA desaturase opposite strand
Extra Details:: This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17.