ABflo[R] 488 Rabbit anti-Rat CD31/PECAM1 monoclonal antibody

Size

POA

SKU:: A25152
Additional Names:: CD31|CD31/PECAM1|Pecam
Application:: Flow Cytometry
Species Reactivity:: Rat
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Species:: Rat
Sequence:: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLA
Uniprot:: Q3SWT0
Synonyms:: CD31;CD31 antigen;CD31/EndoCAM;endoCAM;GPIIA';PECA1;Pecam;PECAM-1;platelet endothelial cell adhesion molecule;platelet endothelial cell adhesion molecule-1;platelet/endothelial cell adhesion molecule 1
Extra Details:: Enables protein phosphatase binding activity. Involved in several processes, including cellular response to interferon-gamma; negative regulation of GTPase activity; and negative regulation of actin filament polymerization. Located in cell surface and ruffle. Used to study pulmonary hypertension. Biomarker of bacterial pneumonia; orchitis; and osteoarthritis. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).

Shipping Conditions:: Blue Ice