ABflo[R] 488 Rabbit anti-Mouse CD126/IL-6RA Alpha chain monoclonal antibody

Size

POA

SKU:: A25149
Additional Names:: CD126|IL-6R|IL-6R-alpha|IL-6RA|Il6r
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
Uniprot:: P22272
Synonyms:: CD126;CD126 antigen;gp80;HIES5;I;IL;IL-1Ra;IL-6 receptor alpha chain;IL-6 receptor subunit alpha;IL-6R;IL-6R 1;IL-6R subunit alpha;IL-6R-1;IL-6R-alpha;IL-6RA;IL6Q;IL6QTL;Il6r;IL6RA;IL6RQ;interleukin-6 receptor subunit alpha;membrane glycoprotein 80
Extra Details:: Enables interleukin-6 binding activity and interleukin-6 receptor activity. Involved in T-helper 17 cell lineage commitment and interleukin-6-mediated signaling pathway. Located in cell surface. Part of interleukin-6 receptor complex. Is expressed in several structures, including adipose tissue; alimentary system; genitourinary system; hemolymphoid system; and nervous system. Human ortholog(s) of this gene implicated in Alzheimer's disease; Huntington's disease; hyper IgE syndrome; obesity; and stomach cancer. Orthologous to human IL6R (interleukin 6 receptor).

Shipping Conditions:: Blue Ice