![ABflo[R] 488 Rabbit anti-Human CD39/ENTPD1 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25059/A25059_1.jpg)
![ABflo[R] 488 Rabbit anti-Human CD39/ENTPD1 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25059/A25059_2.jpg)
![ABflo[R] 488 Rabbit anti-Human CD39/ENTPD1 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25059/A25059_ARC64460-01-ABf488-01(Green)i_FC_01.jpg)
![ABflo[R] 488 Rabbit anti-Human CD39/ENTPD1 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25059/A25059_ARC64460-01-ABf488-01(Green)i_FC_02.jpg)
A25059
ABflo[R] 488 Rabbit anti-Human CD39/ENTPD1 monoclonal antibody
Size
POA
- SKU:
- A25059
- Additional Names:
- ATPDase|CD39|NTPDase-1|SPG64
- Application:
- Flow Cytometry
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK
- Uniprot:
- P49961
- Synonyms:
- ATPDase;CD39;CD39 antigen;ecto-apyrase;ecto-ATP diphosphohydrolase 1;ecto-ATPase 1;ecto-ATPDase 1;ectonucleoside triphosphate diphosphohydrolase 1;lymphoid cell activation antigen;NTPDase-1;SPG64
- Extra Details:
- The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice