ABflo[R] 647 Rabbit anti-Mouse CD28 monoclonal antibody

Size

POA

SKU:: A25057
Additional Names:: Cd28
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
Uniprot:: P31041
Synonyms:: T-cell-specific surface glycoprotein CD28;Tp44
Extra Details:: Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule).