A25052
Bcl-2 Rabbit polyclonal antibody
Size
POA
- SKU:
- A25052
- Additional Names:
- Bcl-2
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
- Uniprot:
- P49950
- Synonyms:
- apoptosis regulator Bcl-2;B cell lymphoma 2 associated oncogene;B-cell CLL/lymphoma 2;B-cell leukemia/lymphoma 2;Bcl-2;Bcl-2alpha;Bcl2-like protein;PPP1R50;protein phosphatase 1, regulatory subunit 50
- Extra Details:
- Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).
- Shipping Conditions:
- Blue Ice