A25049
EPB41 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25049
- Additional Names:
- 4.1R|EL1|HE
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 81kDa/60-135kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTT
- Uniprot:
- P11171
- Synonyms:
- 4.1R;band 4.1;EL1;elliptocytosis 1, RH-linked;EPB4.1;erythrocyte surface protein band 4.1;HE;P4.1;protein 4.1
- Extra Details:
- The protein encoded by this gene, together with spectrin and actin, constitute the red cell membrane cytoskeletal network. This complex plays a critical role in erythrocyte shape and deformability. Mutations in this gene are associated with type 1 elliptocytosis (EL1). Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice