A25041
FNDC5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25041
- Additional Names:
- FNDC5|FRCP2|irisin
- Application:
- ELISA, WB
- Molecular Weight:
- 23kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
- Uniprot:
- Q8NAU1
- Synonyms:
- fibronectin type III domain-containing protein 5;fibronectin type III repeat-containing protein 2;FRCP2;irisin
- Extra Details:
- This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice