A25036
Il15ra Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25036
- Additional Names:
- IL-15RA|Il15ra
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHY
- Uniprot:
- Q60819
- Synonyms:
- AA690181;CD215;IL-15 receptor subunit alpha;IL-15R-alpha;IL-15RA;interleukin 15 receptor, alpha;interleukin-15 receptor subunit alpha
- Extra Details:
- Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).
- Shipping Conditions:
- Blue Ice