CHCHD4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A25029
Additional Names:: CHCHD4|MIA40|TIMM40
Application:: ELISA, WB, IHC-P
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLY
Uniprot:: Q8N4Q1
Synonyms:: coiled-coil-helix-coiled-coil-helix domain-containing protein 4;MIA40;mitochondrial intermembrane space import and assembly protein 40;TIMM40;translocase of inner mitochondrial membrane 40 homolog
Extra Details:: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005