[KD Validated] MCCC1 Rabbit monoclonal antibody

Size

POA

SKU:: A25002
Additional Names:: [KD Validated] MCCC1|MCC-B|MCCA|MCCCalpha
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE
Uniprot:: Q96RQ3
Synonyms:: 3-methylcrotonyl-CoA carboxylase 1;3-methylcrotonyl-CoA carboxylase biotin-containing subunit;3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha;MCC-B;MCCA;MCCase subunit alpha;MCCCalpha;methylcrotonoyl-CoA carboxylase 1 (alpha);methylcrotonoyl-CoA carboxylase alpha;methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial;methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
Extra Details:: This gene encodes the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.