A2500
TTK Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2500
- Additional Names:
- CT96|ESK|MPH1|MPS1|MPS1L1|PYT|TTK
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP
- Uniprot:
- P33981
- Synonyms:
- cancer/testis antigen 96;CT96;dual specificity protein kinase TTK;ESK;monopolar spindle 1 kinase;monopolar spindle 1-like 1;MPH1;MPS1;MPS1L1;phosphotyrosine picked threonine kinase;phosphotyrosine picked threonine-protein kinase;PYT
- Extra Details:
- This gene encodes a dual specificity protein kinase with the ability to phosphorylate tyrosine, serine and threonine. Associated with cell proliferation, this protein is essential for chromosome alignment at the centromere during mitosis and is required for centrosome duplication. It has been found to be a critical mitotic checkpoint protein for accurate segregation of chromosomes during mitosis. Tumorigenesis may occur when this protein fails to degrade and produces excess centrosomes resulting in aberrant mitotic spindles. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice





