ABflo[R] 488 Rabbit anti-Human CD264/TRAIL-R4 monoclonal antibody

Size

POA

SKU:: A24962
Additional Names:: CD264|DCR2|TRAIL-R4|TRAILR4|TRUNDD
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Uniprot:: Q9UBN6
Synonyms:: CD264;DCR2;decoy receptor 2;TNF receptor-related receptor for TRAIL;TNF-related apoptosis-inducing ligand receptor 4;TRAIL receptor 4;TRAIL receptor with a truncated death domain;TRAIL-R4;TRAILR4;TRUNDD;tumor necrosis factor receptor superfamily member 10D;tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.