A24946
POLR2D Rabbit monoclonal antibody

Size
POA
- SKU:
- A24946
- Additional Names:
- HSRBP4|HSRPB4|POLR2D|RBP4|RPB16|RPB4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 16 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
- Uniprot:
- O15514
- Synonyms:
- DNA-directed RNA polymerase II 16 kDa polypeptide;DNA-directed RNA polymerase II subunit D;DNA-directed RNA polymerase II subunit RPB4;HSRBP4;HSRPB4;polymerase (RNA) II (DNA directed) polypeptide D;polymerase (RNA) II subunit D;RBP4;RNA polymerase II 16 kDa subunit;RNA polymerase II subunit B4;RNA polymerase II subunit hsRBP4;RNA polymerase II subunit hsRPB4;RPB16;RPB4
- Extra Details:
- This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene.
- Shipping Conditions:
- Blue Ice








