ABflo[R] 488 Rabbit anti-Mouse CD69 monoclonal antibody

Size

POA

SKU:: A24938
Additional Names:: 5830438K24Rik|AIM|VEA
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
Uniprot:: P37217
Synonyms:: 5830438K24Rik;A;activation inducer molecule (AIM/CD69);AI452015;AIM;BL-AC/P26;C-type lectin domain family 2, member C;CD69 antigen (p60, early T-cell activation antigen);CLEC2C;EA1;early activation antigen CD69;early lymphocyte activation antigen;early T-cell activation antigen p60;GP32/28;leukocyte surface antigen Leu-23;MLR-3;V;VEA;Very Early Activation Antigen
Extra Details:: Predicted to enable calcium ion binding activity and identical protein binding activity. Located in external side of plasma membrane. Orthologous to human CD69 (CD69 molecule).