[KD Validated] PSMA7 Rabbit monoclonal antibody

Size

POA

SKU:: A24916
Additional Names:: [KD Validated] PSMA7|C6|HEL-S-276|HSPC|RC6-1|XAPC7
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
Uniprot:: O14818
Synonyms:: C6;epididymis secretory protein Li 276;HEL-S-276;HSPC;proteasome (prosome, macropain) subunit, alpha type, 7;proteasome subunit alpha 4;proteasome subunit alpha 7;proteasome subunit alpha type-7;proteasome subunit RC6-1;proteasome subunit XAPC7;RC6-1;testicular tissue protein Li 151;XAPC7
Extra Details:: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9.

Shipping Conditions:: Blue Ice