A24884
LHCGR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24884
- Additional Names:
- HHG|LCGR|LGR2|LH/CG-R|LH/CGR|LHCGR|LHR|LHRHR|LSH-R|lutropin-choriogonadotropic hormone receptor|ULG5
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 94kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
- Uniprot:
- P22888
- Synonyms:
- HHG;hypergonadotropic hypogonadism;LCGR;LGR2;LH/CG-R;LH/CGR;LHR;LHRHR;LSH-R;Luteinizing hormone receptor;lutropin-choriogonadotropic hormone receptor;lutropin/choriogonadotropin receptor;ULG5
- Extra Details:
- This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia.
- Shipping Conditions:
- Blue Ice



