LHCGR Rabbit polyclonal antibody

Size

£152.00

SKU:: A24884
Additional Names:: HHG|LCGR|LGR2|LH/CG-R|LH/CGR|LHCGR|LHR|LHRHR|LSH-R|lutropin-choriogonadotropic hormone receptor|ULG5
Application:: ELISA, WB, IF
Molecular Weight:: 94kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
Uniprot:: P22888
Synonyms:: HHG;hypergonadotropic hypogonadism;LCGR;LGR2;LH/CG-R;LH/CGR;LHR;LHRHR;LSH-R;Luteinizing hormone receptor;lutropin-choriogonadotropic hormone receptor;lutropin/choriogonadotropin receptor;ULG5
Extra Details:: This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia.