LAP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24875
Additional Names:: CMD1T|LAP2|LEMD4|PRO0868|thymopoietin|TMPO|TP
Application:: ELISA, WB
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSS
Uniprot:: P42166, P42167
Synonyms:: CMD1T;lamina-associated polypeptide 2;LAP2;LEM domain containing 4;LEMD4;PRO0868;thymopoietin;Thymopoietin isoform alpha;Thymopoietin-related peptide isoform alpha;Thymopoietin-related peptide isoforms beta/gamma;Thymopoietin, isoforms beta/gamma;TP
Extra Details:: The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.