A24868
MDA5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24868
- Additional Names:
- AGS7|Hlcd|IDDM19|IFIH1|interferon induced with helicase C domain 1|MDA-5|MDA5|RLR-2|SGMRT1
- Application:
- ELISA, WB
- Molecular Weight:
- 135 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS
- Uniprot:
- Q9BYX4
- Synonyms:
- AGS7;CADM-140 autoantigen;clinically amyopathic dermatomyositis autoantigen 140 kDa;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide;helicard;helicase with 2 CARD domains;Hlcd;IDDM19;interferon-induced helicase C domain-containing protein 1;Interferon-induced with helicase C domain protein 1;MDA-5;MDA5;melanoma differentiation-associated gene 5;melanoma differentiation-associated protein 5;murabutide down-regulated protein;RIG-I-like receptor 2;RLR-2;RNA helicase-DEAD box protein 116;SGMRT1
- Extra Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19.
- Shipping Conditions:
- Blue Ice