SLC1A7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24854
Additional Names:: AAAT|EAAT5|SLC1A7|solute carrier family 1 member 7
Application:: ELISA, WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV
Uniprot:: O00341
Synonyms:: AAAT;EAAT5;excitatory amino acid transporter 5;excitatory amino acid transporter 5 (retinal glutamate transporter);retinal glutamate transporter;solute carrier family 1 (glutamate transporter), member 7;Solute carrier family 1 member 7
Extra Details:: Predicted to enable anion transmembrane transporter activity. Involved in neurotransmitter reuptake. Predicted to be located in plasma membrane. Predicted to be active in glutamatergic synapse. Predicted to be integral component of postsynaptic membrane and integral component of presynaptic membrane.