A24837
ST3GAL4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24837
- Additional Names:
- 3-sialyltransferase 4|CGS23|gal-NAc6S|NANTA3|SAT3|SIAT4|SIAT4C|ST-4|ST3 beta-galactoside alpha-2|ST3GAL4|ST3GalA.2|ST3GalIV|STZ
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
- Uniprot:
- Q11206
- Synonyms:
- alpha 2,3-sialyltransferase IV;alpha 2,3-ST 4;alpha-3-N-acetylneuraminyltransferase;beta-galactoside alpha-2,3-sialyltransferase 4;CGS23;CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4;gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase;gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase;gal-beta-1,4-GlcNAc-alpha-2,3-sialyltransferase;gal-NAc6S;N-acetyllactosaminide alpha-2,3-sialyltransferase;NANTA3;SAT-3;SAT3;Sialyltransferase 4C;sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase);sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase);SIAT4;SIAT4C;ST-4;ST3Gal IV;ST3GalA.2;ST3GalIV;STZ
- Extra Details:
- This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

