A24827
CD8B Beta Rabbit monoclonal antibody

Size
POA
- SKU:
- A24827
- Additional Names:
- CD8B1|CD8beta|CD8B Beta|LEU2|Ly-3|LY3|LYT3|P37
- Application:
- ELISA, Flow Cytometry, WB
- Molecular Weight:
- 20kDa/23-45 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
- Uniprot:
- P10966
- Synonyms:
- CD8 antigen, beta polypeptide 1 (p37);CD8B1;LEU2;LY3;LYT3;P37;T lymphocyte surface glycoprotein beta chain;T-cell surface glycoprotein CD8 beta chain
- Extra Details:
- The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.
- Shipping Conditions:
- Blue Ice








