[KD Validated] Sharpin Rabbit monoclonal antibody

Size

POA

SKU:: A24809
Additional Names:: [KD Validated] Sharpin|SIPL1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNG
Uniprot:: Q9H0F6
Synonyms:: hSIPL1;shank-associated RH domain-interacting protein;shank-interacting protein-like 1;sharpin;SIPL1
Extra Details:: Enables polyubiquitin modification-dependent protein binding activity. Involved in protein linear polyubiquitination and regulation of signal transduction. Located in cytosol. Part of LUBAC complex.