MTCO1 Rabbit monoclonal antibody

Size

POA

SKU:: A24805
Additional Names:: COX1|CoxI|MTCO1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 37 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Uniprot:: P00395
Synonyms:: COI;Cytochrome c oxidase polypeptide I;cytochrome c oxidase subunit I;MTCO1
Extra Details:: Enables cytochrome-c oxidase activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, cytochrome c to oxygen; and response to oxidative stress. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex IV. Is expressed in several structures, including brown fat; heart; liver; metanephros; and skeletal muscle. Orthologous to human MT-CO1 (mitochondrially encoded cytochrome c oxidase I).