PE Rabbit anti-Mouse CD262/DR5/TRAILR2 monoclonal antibody

Size

POA

SKU:: A24798
Additional Names:: DR5|KILLER|Ly98|MK|TRAILR2|TRICK2A|TRICK2B|TRICKB
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCV
Uniprot:: Q9QZM4
Synonyms:: apoptosis inducing protein TRICK2A/2B;apoptosis inducing receptor TRAIL-R2;CD262;cytotoxic TRAIL receptor-2;death domain containing receptor for TRAIL/Apo-2L;death receptor 5;DR;DR5;Fas-like protein;KI;Kille;KILLER;KILLER/DR5;KILLER/DR5 TRAIL death-inducing receptor;Ly9;Ly98;MK;p53-regulated DNA damage-inducible cell death receptor(killer);TNF-related apoptosis-inducing ligand receptor 2;TR;TRA;TRAIL-R2;TRAILR2;TRIC;TRICK;TRICK2;TRICK2A;TRICK2B;TRICKB;tumor necrosis factor receptor superfamily member 10B;tumor necrosis factor receptor superfamily, member 10b;tumor necrosis factor receptor-like protein ZTNFR9;ZTNFR9
Extra Details:: Predicted to enable TRAIL receptor activity; identical protein binding activity; and protease binding activity. Predicted to be involved in TRAIL-activated apoptotic signaling pathway and positive regulation of apoptotic process. Predicted to act upstream of or within apoptotic process and regulation of apoptotic process. Predicted to be located in Golgi apparatus; cytosol; and membrane raft. Predicted to be active in cell surface and plasma membrane. Is expressed in bladder; liver; renal vasculature; urethra of female; and urethra of male. Human ortholog(s) of this gene implicated in carcinoma (multiple); cervical cancer; hematologic cancer (multiple); and urinary bladder cancer. Orthologous to several human genes including TNFRSF10A (TNF receptor superfamily member 10a).

Shipping Conditions:: Blue Ice