A24783
GPAM Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24783
- Additional Names:
- glycerol-3-phosphate acyltransferase|GPAM|GPAT|GPAT1|mitochondrial
- Application:
- ELISA, WB
- Molecular Weight:
- 90-93kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLE
- Uniprot:
- Q9HCL2
- Synonyms:
- glycerol-3-phosphate acyltransferase 1, mitochondrial;GPAT;GPAT-1;GPAT1
- Extra Details:
- This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.
- Shipping Conditions:
- Blue Ice