[KD Validated] MRPL11 Rabbit polyclonal antibody

Size

POA

SKU:: A24775
Additional Names:: CGI-113|L11MT|mitochondrial ribosomal protein L11|MRP-L11|MRPL11
Application:: ELISA, WB, IP
Molecular Weight:: 21kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK
Uniprot:: Q9Y3B7
Synonyms:: 39S ribosomal protein L11, mitochondrial;CGI-113;L11MT;mitochondrial large ribosomal subunit protein uL11m;MRP-L11
Extra Details:: This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.