A24765
ROMO1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24765
- Additional Names:
- bA353C18.2|C20orf52|MTGM|MTGMP|ROMO1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 8kDa/10kDa/10kDa/8kDa/8kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
- Uniprot:
- P60602
- Synonyms:
- bA353C18.2;C20orf52;epididymis tissue protein Li 175;glyrichin;mitochondrial targeting GxxxG motif protein;mitochondrial targeting GXXXG protein;MTGM;MTGMP;PCM19;protein MGR2 homolog;reactive oxygen species modulator 1;ROS modulator 1
- Extra Details:
- The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.
- Shipping Conditions:
- Blue Ice