A24763
CYP11B2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24763
- Additional Names:
- ALDOS|CPN2|CYP11B|CYP11B2|CYP11BL|CYPXIB2|cytochrome P450 11B2|mitochondrial|P-450C18|P450aldo|P450C18
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKL
- Uniprot:
- P19099
- Synonyms:
- ALDOS;aldosterone synthase;aldosterone-synthesizing enzyme;corticosterone 18-monooxygenase, CYP11B2;CPN2;CYP11B;CYP11BL;CYPXIB2;cytochrome P-450Aldo;cytochrome P-450C18;cytochrome P450 11B2, mitochondrial;cytochrome P450, family 11, subfamily B, polypeptide 2;cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2;mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2;P-450C18;P450aldo;P450C18;steroid 11-beta-hydroxylase, CYP11B2;steroid 11-beta-monooxygenase;steroid 11-beta/18-hydroxylase;Steroid 18-hydroxylase;steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has steroid 18-hydroxylase activity to synthesize aldosterone and 18-oxocortisol as well as steroid 11 beta-hydroxylase activity. Mutations in this gene cause corticosterone methyl oxidase deficiency.
- Shipping Conditions:
- Blue Ice







