A24759
FABP1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24759
- Additional Names:
- FABP1|FABPL|fatty acid binding protein 1|L-FABP
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS
- Uniprot:
- P07148
- Synonyms:
- FABPL;fatty acid binding protein 1, liver;Fatty acid-binding protein 1;fatty acid-binding protein, liver;L-FABP;liver-type fatty acid-binding protein
- Extra Details:
- This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
- Shipping Conditions:
- Blue Ice