ABflo[R] 488 Rabbit anti-Human CD300F/IREM-1 monoclonal antibody

Size

POA

SKU:: A24704
Additional Names:: CD300f|CD300LF|CLM-1|CLM1|CMRF35-like molecule 1|IgSF13|IREM-1|IREM1|LMIR3|NKIR
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Uniprot:: Q8TDQ1
Synonyms:: CD300 antigen-like family member F;CD300f;CLM-1;CLM1;CMRF35-like molecule 1;IgSF13;immune receptor expressed on myeloid cells 1;immunoglobin superfamily member 13;immunoglobulin superfamily member 13;inhibitory receptor IREM1;IREM-1;IREM1;LMIR3;NK inhibitory receptor;NKIR
Extra Details:: This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants.