ABflo[R] 488 Rabbit anti-Human CD35 monoclonal antibody

Size

POA

SKU:: A24697
Additional Names:: C3BR|C4BR|CD35|complement receptor type 1|CR1|KN
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRC
Uniprot:: P17927
Synonyms:: C3-binding protein;C3b/C4b receptor;C3BR;C4BR;CD35;CD35 antigen;complement component (3b/4b) receptor 1 (Knops blood group);complement receptor 1;complement receptor type 1;KN;Knops blood group antigen
Extra Details:: Complement receptor type 1 (CR1/CD35) is a type I transmembrane glycoprotein that is expressed on the surface of B cells, neutrophils, monocytes, and renal podocytes. As a component of the host's innate immune system, CR1/CD35 expressed on neutrophils and monocytes binds to ligands coated with complement opsonins C3b and C4b, thereby promoting phagocytosis and pro-inflammatory cytokine production. CR1/CD35 also participates in negative regulation of the complement cascade through its ability to promote dissociation of C3 and C5 convertases and by serving as one of multiple cofactors for factor-I-mediated cleavage and inactivation of C3b and C4b.

Shipping Conditions:: Blue Ice