[KD Validated] eIF4EBP1 Rabbit monoclonal antibody

Size

POA

SKU:: A24691
Additional Names:: 4E-BP1|4EBP1|BP-1|eIF4EBP1|PHAS-I
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 15-20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Uniprot:: Q13541
Synonyms:: 4E-BP1;4EBP1;BP-1;eIF4E-binding protein 1;eukaryotic translation initiation factor 4E-binding protein 1;PHAS-I;phosphorylated heat- and acid-stable protein regulated by insulin 1
Extra Details:: This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.