MKP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24667
Additional Names:: CL100|HVH1|MKP-1|MKP1|PTPN10
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Uniprot:: P28562
Synonyms:: CL 100;CL100;dual specificity protein phosphatase 1;dual specificity protein phosphatase hVH1;HVH1;MAP kinase phosphatase 1;mitogen-activated protein kinase phosphatase 1;MKP-1;MKP1;protein-tyrosine phosphatase CL100;PTPN10;serine/threonine specific protein phosphatase
Extra Details:: The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy.