A24667
MKP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24667
- Additional Names:
- CL100|HVH1|MKP-1|MKP1|PTPN10
- Application:
- ELISA, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
- Uniprot:
- P28562
- Synonyms:
- CL 100;CL100;dual specificity protein phosphatase 1;dual specificity protein phosphatase hVH1;HVH1;MAP kinase phosphatase 1;mitogen-activated protein kinase phosphatase 1;MKP-1;MKP1;protein-tyrosine phosphatase CL100;PTPN10;serine/threonine specific protein phosphatase
- Extra Details:
- The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy.
- Shipping Conditions:
- Blue Ice

