A24664
MYH7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24664
- Additional Names:
- CMD1S|CMH1|CMYP7A|CMYP7B|MPD1|MYH7|MYHCB|SPMD|SPMM
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 251 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDC
- Uniprot:
- P12883
- Synonyms:
- cardiac muscle myosin heavy chain 7 beta;CMD1S;CMH1;MPD1;myHC-beta;myhc-slow;MYHCB;myopathy, distal 1;myosin 7;Myosin heavy chain 7;myosin heavy chain beta-subunit;Myosin heavy chain slow isoform;Myosin heavy chain, cardiac muscle beta isoform;myosin-7;myosin, heavy chain 7, cardiac muscle, beta;myosin, heavy polypeptide 7, cardiac muscle, beta;rhabdomyosarcoma antigen MU-RMS-40.7A;SPMD;SPMM
- Extra Details:
- Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing distal myopathy.
- Shipping Conditions:
- Blue Ice








