A24650
H2-Ab1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A24650
- Additional Names:
- Abeta|H-2Ab|H2-Ab|H2-Ab1|I-Abeta|Ia-2|Ia2|IAb|Rmcs1
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ
- Uniprot:
- P06345
- Synonyms:
- Abe;Abeta;AI845868;H-2 class II histocompatibility antigen, A beta chain;H-2A;H-2Ab;H2-A;H2-Ab;H2-Ab_;H2A Barr body-deficient;H2A histone family member B1;H2A.B;H2A.Bbd;H2AFB1;histocompatibility 2, class II antigen A, beta 1;histocompatibility 2, class II antigen A, beta, promoter 1;histone H2A-Bbd type 1;I;I-A<;I-Ab;I-Abeta;Ia;Ia-2;Ia2;IAb;major histocompatibility complex class II beta chain;MHC class II H2-IA-beta-psi;response to metastatic cancers 1;Rmc;Rmcs1
- Extra Details:
- Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).
- Shipping Conditions:
- Blue Ice





