TOMM40 Rabbit monoclonal antibody

Size

POA

SKU:: A24644
Additional Names:: C19orf1|D19S1177E|PER-EC1|PEREC1|TOM40|TOMM40
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 41kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKC
Uniprot:: O96008
Synonyms:: C19orf1;D19S1177E;mitochondrial import receptor subunit TOM40 homolog;mitochondrial outer membrane protein;p38.5;PER-EC1;PEREC1;protein Haymaker;TOM40;translocase of outer membrane 40 kDa subunit homolog;translocase of outer mitochondrial membrane 40 homolog
Extra Details:: The protein encoded by this gene is localized in the outer membrane of the mitochondria. It is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for import of protein precursors into mitochondria. Alternatively spliced transcript variants have been found for this gene.